Research use only
Glow Blend combines BPC-157, TB-500 and GHK-Cu, studied together for their potential roles in tissue recovery, inflammation modulation and cellular regeneration. Research explores their combined influence on wound repair and collagen activity.
Triple-peptide complex for repair and regenerative pathway research
Research use only
Glow Blend combines BPC-157, TB-500 and GHK-Cu, studied together for their potential roles in tissue recovery, inflammation modulation and cellular regeneration. Research explores their combined influence on wound repair and collagen activity.
| BPC-157 | |
| Molecular Formula | C62H98N16O22 |
| Sequence | GEPPPGKPADDAGLV |
| CAS Number | 137525-51-0 |
| TB-500 | |
| Molecular Formula | C212H350N56O78S |
| Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| CAS Number | 77591-33-4 |
| GHK-Cu | |
| Molecular Formula | C16H26CuN6O6 |
| Sequence | GHK |
| CAS Number | 300801-03-0 |
Supplied as a lyophilized blend. Store at –20°C away from moisture and light.
For laboratory research use only.
Supplied as a lyophilized blend. Store at –20°C away from moisture and light.
For laboratory research use only.
Frequently bought together: GLP-1 S (5 mg, 10 mg), GLP-2 T (5 mg, 10 mg), GLP-3 R (5mg, 10mg)
Explore atomik peptides from Atomix Research, including premium Peptide Blends manufactured for laboratory research, analytical testing, and qualified research applications.
Related Peptide Blends: BPC-157/TB-500 Blend (5/5 mg) | CJC-1295/Ipamorelin Blend (5/5 mg)
Disclaimer: For research use only. Not for human consumption.
Related products
GLP-1 Peptides
