Research use only
IGF-1 LR3 is a potent synthetic analog of insulin-like growth factor 1, featuring an arginine substitution at position three and an additional 13 amino acids at the N-terminus. These modifications make it significantly more potent and longer-lasting than native IGF-1, enhancing its effectiveness in stimulating cell growth, muscle repair, and metabolic activity. Researchers use IGF-1 LR3 in studies of tissue regeneration, lean mass development, fat metabolism, and endocrine signaling. Atomix Research supplies it in high purity, ensuring consistent and reliable performance in advanced laboratory settings.
Long-Acting IGF-1 Analog for Growth, Repair & Metabolic Research
IGF-1 LR3 is a potent synthetic analog of insulin-like growth factor 1, featuring an arginine substitution at position three and an additional 13 amino acids at the N-terminus. These modifications make it significantly more potent and longer-lasting than native IGF-1, enhancing its effectiveness in stimulating cell growth, muscle repair, and metabolic activity. Researchers use IGF-1 LR3 in studies of tissue regeneration, lean mass development, fat metabolism, and endocrine signaling. Atomix Research supplies it in high purity, ensuring consistent and reliable performance in advanced laboratory settings.
| Synonyms | Long R3-IGF-1, LR3-IGF-1, Long arginine 3 IGF-1 |
| Molecular Formula | C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉ |
| Molecular Weight | ~9117.5 g/mol |
| CAS Number | 946870-92-4 |
| Amino Acid Sequence | MFPAMPLSSL FVNGPRTLCGA ELVDALQFVC GDRGFYFNKPT GYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Appearance | White Lyophilized Powder |
Supplied in a sealed sterile vial to maintain maximum stability and purity. Store in a cool, dry place away from direct sunlight and moisture. Recommended storage temperature is 2–8°C for long-term preservation. After reconstitution, keep refrigerated at 2–8°C and avoid repeated freeze-thaw cycles. Proper handling ensures optimal stability for research applications.
For laboratory research only – not for human use
Supplied in a sealed sterile vial to maintain maximum stability and purity. Store in a cool, dry place away from direct sunlight and moisture. Recommended storage temperature is 2–8°C for long-term preservation. After reconstitution, keep refrigerated at 2–8°C and avoid repeated freeze-thaw cycles. Proper handling ensures optimal stability for research applications.
For laboratory research only – not for human use
Frequently bought together: Ipamorelin (5mg), Melanotan 2 (10 mg), Bronchogen 20mg
Explore atomik peptides from Atomix Research, including premium Peptides manufactured for laboratory research, analytical testing, and qualified research applications.
Related Peptides: MOTS-C (10 mg) | NAD+ (500 mg) | Oxytocin 5mg
Disclaimer: For research use only. Not for human consumption.
Related products
